Ракетный блок. P230. [Редактировать]

Блок собирается непосредственно на космодроме Куру и состоит из трех секции, толщина стальных стенок конструкции 8 мм. Две первые секции включают три 3.35 метровых цилиндра. Топливо состоит из 68%-го перхлората аммония, 18% алюминия; 3.4 метровые секции, поставляются из Италии. Система управления позволяет отклонять вектор тяги на величену 6 °. В планах стоит перевод систем на многоразовое исполнение за счет встраивания в блоки парашютных систем, однако данное решение приведет к падению массы полезной нагрузки, выводимой на ГТО, в размере 100 кг.

Дополнительные наименования

#НаименованияПоиск в новостяхПоиск в документах

Технические характеристики

2Тяга, кН6470
3Удельный импульс (пустота), с275
4Удельный импульс (Земля), с250
5Время работы, с129
6Масса изделия, кг278330
7Масса изделия (сухая), кг38200
8Диаметр, метра3.05
9Высота, метра31.60

Экономические характеристики

#ХарактеристикаДата измеренияЗначение
1Стоимость (изготовления), млн. долл.22
2Производитель (сборка)EADS Launch Vehicles
3Производитель (двигателя)Europropulsion
4Количество (изготовленных блоков), шт.11

Найдено 132 документов по запросу «P230». [Перейти к поиску]

Дата загрузки: 2016-12-29
Скачать документ
Скачать текст
... A-sensitive transGolgi network-localised protein (p230) that is associated with a population... levels of GFP-p230-C98aa fusion protein, endogenous p230 was no longer... binding characteristics to wild-type p230. INTRODUCTION complex. Clathrin-coated vesicles... a 230 kDa peripheral membrane protein (p230) specifically associated with vesicles budding... activation of G proteins demonstrated that p230 is specifically recruited on budding...: Trans-Golgi network, Golgi localisation, p230 1646 L. Kjer-Nielsen and others... action of p230, we have identified the sequence of p230 responsible for... antibodies to the glutathione-Stransferase-p230 fusion protein were generated in... on the N terminus of p230, pSVT7-p230 was used as template to... SacII/SpeI fragment of pSVT7-p230 (pSVT7myc-p230). A construct lacking the C-terminal... amino acids of p230 was generated using pSVT7-p230 as template to.../SpeI-digested pSVT7-p230. For GFP-p230 gene constructions, pSVT7-p230 was used... 5′-CCGGAATTCTCAAGCATCTTCTCTTTCACC-3′ were used. All GFP-p230 hybrid genes was verified by... the alternatively spliced C terminus of p230, the primers 5′-CCGGAATTCTGAACAGATTCACAATTTA-3′ and 5′CCGGAATTCTCAAGATGAAGATCGGAG... mutagenesis Mutagenesis of the GFP-p230-C98aa construct involving serial 4- or... of the C-terminal domain of p230, the primers 5′-CGTATGGTACAAATTGCC-3′ and 5′-GATGTCTCACTCTTTGGAGCAGCTGCAGCAGCTGCATATTTGCGAAAAGTGCTT... sequence of p230 1647 To construct GFP and GFP-p230 genes under... C-terminal domain of p230 is required for Golgi targeting p230 is a peripheral... of a full-length p230. Furthermore, the myc-tagged p230 was localised to... myc-wt-p230 ∆N-p230 myc-p230-∆C GFP-p230-C98aa Fig. 1. Structure of p230 mutants and GFP fusion protein. Fulllength p230... Fig. 2. Immunoblotting and immunoprecipitation of p230 products from transfected cells. Total... expression vectors encoding myc-p230 and GFP-p230-C98aa and metabolically labeled... anti-p230 antibodies for the Nterminal deletion. Although the anti-p230 antibodies recognise both human and simian p230, transfected COS cells expressing the p230 N-terminal deletion... transfected cells (Fig. 3). The N-terminal p230 deletion mutant was localised to... 98 amino acids of p230 abrogates localisation of p230 to the Golgi... p230 alone were sufficient for targeting of p230 to Golgi membranes, the p230.... 3. Deletion of C-terminal domain of p230 abolishes Golgi targeting. COS cells... constructs encoding myc-wt-p230, ∆N-p230 and myc-p230-∆C, as indicated, and 48...-wt-p230 and myc-p230-∆C) or with affinity-purified rabbit anti-p230 fusion... CY3-conjugated anti-rabbit Ig (∆N-p230). Confocal immunofluorescence images are shown... GFP-p230-C98aa with the anti-p230 antibodies revealed that GFP-p230-C98aa... vectors encoding both myc-p230 and GFP-p230-C98aa, metabolically labeled and...). No association between myc-p230 and GFP-p230-98aa was detected. Monoclonal... not form complexes with endogenous p230. Fig. 4. GFP fusion protein containing...-p230-C98aa transfected COS cells stained for endogenous p230 using human anti-p230... colocalisation of GFP-p230-C98 and p230 (yellow). endogenous p230 (Fig. 4B-D). Identical... also obtained using a rabbit anti-p230 fusion protein antibody, which recognises... results in loss of endogenous p230 from Golgi membranes. Confocal immunofluorescence... and stained for endogenous p230 using human anti-p230 antibody followed by... of GFP-p230-C98a. On the other hand, GFP-p230- C98a fusion... the Golgi Localisation A 1 98 +++ +++ +++ ++ ++ + GFP-p230-C98aa C31-98aa C40-98aa... of GFP-p230-C98 in transfected COS cells. GFP-p230-C98 constructs... Golgi-localisation of p230. A COOH-terminal splice variant of p230 localises to... examined the localisation of a GFP-p230 fusion protein containing the alternatively... localisation of p230. Fig. 8. (A) Alanine scanning mutagenesis of GFP-p230-C98aa. COS... C terminus of p230 or through other regions of p230, the effect of... the perinuclear localisation of GFP-p230-C98aa after a 2 minute brefeldin A treatment... 98 EPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMSWLRSSS 1 44 88 +++ ++ +/++ +++ GFP-p230-C98aa A41-46 A47-52... antibodies specific for the endogenous p230 revealed a Numerous peripheral membrane proteins... proteins has not been defined. p230 is a peripheral membrane protein specifically... domain of p230 prevents the recruitment of endogenous p230 to TGN membranes..., since GFP-p230-C98 fusion protein prevents endogenous p230 from binding to... with similar characteristics to endogenous p230. The immunofluorescence data of stably... displays similar characteristics to endogenous p230, the brefeldin A sensitivity and regulation... domain, and p230. Although the localisation and behaviour of p230 suggests a role... the overexpression of the minimum p230 targeting sequence in stably transfected...). Molecular characterization of trans-Golgi p230 – A human peripheral membrane protein encoded..., J. L., Griffiths, G., Toh, B. H. and Matheson, F. (1996). p230 is associated with vesicles budding...

Дата загрузки: 2017-01-16
Скачать документ
Скачать текст
... ASSESSMENT REPORT for Modification Proposal P230 ‘Enabling Interoperability through the use...: Version Number: P230AR 1.0 Proposed Modification P230 seeks to mandate the use... market. MODIFICATION GROUP’S RECOMMENDATIONS The P230 Modification Group invites the Panel to: • AGREE a provisional recommendation that P230 Proposed Modifications should be made... Modifications; • AGREE that Modification Proposal P230 should be submitted to the.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report Page 2 of 16... Electricity Supply Licence ........................................................ 5 The Issue ................................................................................................................... 5 3 P230 Solution.........................................................................................................7 4 4.1 4.2 4.3 Initial Group Discussions .......................................................................................8 Measurements Instruments Directive ............................................................................ 8 Initial Implementation Timescales................................................................................. 9 P230 Benefit Analysis................................................................................................... 9 5 5.1 5.2 What did Industry... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 1 Page 3 of 16... Summary of Proposal Objective of P230: P230 aims to reduce interoperability issues... the United Kingdom. Proposed Solution: P230 proposes to introduce a requirement within... in P230; • Issue an impact assessment/consultation to identify the P230 implementation... Modification Group as to whether P230 better facilitates the achievement of... of Practise (CoPs) subject to P230 being recommended by the Modification... the IWA for additional comments: P230 IWA Implementation Costs The estimated.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report Page 4 of 16... delivers the intended solution for P230? 8 0 Would P230 impact your Organisation? 4 1 Modification... Group’s unanimous recommendation is that P230 Proposed Modification SHOULD be made. Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 2 Page 5 of 16... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report Page 6 of 16... 2009 P230 Assessment Report 3 Page 7 of 16 P230 SOLUTION Modification Proposal P230 has... refer to the following link: P230 Background Documentation. 3.1.1 Balancing and Settlement... in Attachment 1. 3.1.2 Codes of Practise P230 will necessitate a change to the... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 4 Page 8 of 16 INITIAL GROUP DISCUSSIONS The P230 Modification Group ‘the Group’ met.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 4.2 Page 9 of 16... date (see section 6 for conclusions). 4.3 P230 Benefit Analysis The Group discussed... and drawbacks of P230. It was acknowledged that P230 is fundamentally about.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 5 Page 10 of... details please see Appendix 6: • Does P230 better facilitate the Applicable BSC... the Modification Groups view that P230 does better facilitate the applicable...? Respondents unanimously believed that the P230 legal text delivered the intended... be appropriate for addressing the P230 solution. One respondent felt that... any quantifiable benefits associated with P230? The majority of respondents agreed... with P230. Some respondents believed that the quantifiable benefits of P230 would... please see Appendix 7: • How will P230 impact your organisation? The majority... arising from P230. In addition the respondent believed that P230 would reduce.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 6 Page 11 of... assessment and consultation responses, the P230 Group met to consider the.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 6.3 Page 12 of... Report. 6.4 Disadvantages of not Implementing P230 A Group member noted that although... not implementing P230. The Group member believed that if P230 was not.... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 7 Page 13 of... the current baseline and that P230 better facilitates: BSC Objective (C) & (D) The... recommendation is that Modification Proposal P230 Modification SHOULD be made. Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report 8 Page 14 of... Directive 8.1 Ref. 1 2 3 References Document Title P230 Modification Proposal Advanced Metering Operational... Assessment Issued 02/02/09 P230 Consultation and Impact Assessment responses... Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report Page 15 of... X √ Version Number: 1.0 © ELEXON Limited 2009 P230 Assessment Report Page 16 of... REFERENCE Modification Proposal P230 will be considered by the P230 Modification Group... Reference and the Appendix attached. P230 – Enabling Interoperability through the use.... It is suggested that the P230 Modification Group consider recommendations highlighted...

Дата загрузки: 2017-04-09
Скачать документ
Скачать текст
... G71 U1 R0.5 N210 G71 P230 Q310 U0.3 W0.3 F0.5 N220... G71 U1 R0.5 N210 G71 P230 Q310 U0.3 W0.3 F0.5 N220... G71 U1 R0.5 N210 G71 P230 Q310 U0.3 W0.3 F0.5 N220... G71 U1 R0.5 N210 G71 P230 Q310 U0.3 W0.3 F0.5 N220... G71 U1 R0.5 N290 G71 P230 Q310 U0.3 W0.3 F0.5 N300...

Дата загрузки: 2017-01-16
Скачать документ
Скачать текст
Intel® Z-P230 PATA Solid State Drive SSDPAMM0004G1, ... Reserved for Future Use Intel Z-P230 PATA SSD Ordering Information Packaging... Corporation. All Rights Reserved. Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Contents 1.0 Overview ................................................................................................................... 5 1.1 Key...® Z-P230 PATA Solid State Drive Product Manual 3 Intel® Z-P230 PATA SSD Intel® Z-P230...-003US Intel® Z-P230 PATA SSD 1.0 Overview The Intel® Z-P230 PATA Solid-State..., low-power storage. The Intel Z-P230 PATA SSD is electronically-drop... 1. Front View of the Intel Z-P230 PATA SSD with ZIF Connector... 2. Front View of the Intel Z-P230 PATA SSD with Mini PCIe... Intel® Z-P230 PATA Solid State Drive Product Manual 5 Intel® Z-P230 PATA SSD... mm (W) x 3.8 mm (H) 1.2 Architecture The Intel Z-P230 PATA Solid State Drive is... PATA controller in the Intel® Z-P230 PATA Solid State Drive uses... 3, “Functional Block Diagram of Intel Z-P230 PATA Solid State Drive” on... to minimize system overhead. Intel Z-P230 PATA Solid State Drives use... and interleaved die operations. Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 1.3 Block Diagram Figure 3. Functional Block Diagram of Intel Z-P230 PATA Solid State Drive PATA... Memory Regulatory Compliance The Intel Z-P230 PATA SSD is compliant with... electronic compliance. Since the Intel Z-P230 PATA SSD is intended to...-user systems. While the Intel Z-P230 PATA SSD is EMC compliant... Intel® Z-P230 PATA Solid State Drive Product Manual 7 Intel® Z-P230 PATA SSD...-operating temperature Tstg 0 85 °C Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 3.3.2 Recommended Operating Conditions... Intel® Z-P230 PATA Solid State Drive Product Manual 9 Intel® Z-P230 PATA SSD.... 3.5.5 Electrostatic Discharge (ESD) The Intel Z-P230 PATA SSD can withstand an... data written is random. Intel® Z-P230 PATA Solid State Drive Product...-003US Intel® Z-P230 PATA SSD 4.0 Mechanical Information Figure 4. Intel Z-P230 PATA SSD....com electronic components distributor Intel® Z-P230 PATA Solid State Drive Product Manual 11 Intel® Z-P230 PATA SSD Figure 5. Note: ZIF... dimensions are in millimeters. Intel® Z-P230 PATA Solid State Drive Product...: 319955-003US Intel® Z-P230 PATA SSD Figure 6. Intel Z-P230 PATA SSD with....com electronic components distributor Intel® Z-P230 PATA Solid State Drive Product Manual 13 Intel® Z-P230 PATA SSD 5.0 Pin Assignments and... 5.1 Pin Assignments Table 10. Intel Z-P230 with ZIF Connector - 40 Pin... DMARQ 32 PDIAG# Signal Intel Z-P230 with Mini PCIe Form Factor... 39 DA1 GND 40 Intel® Z-P230 PATA Solid State Drive Product...-003US Intel® Z-P230 PATA SSD Table 11. Note: Intel Z-P230 with Mini... the device. Power supply. Intel® Z-P230 PATA Solid State Drive Product... 15 Intel® Z-P230 PATA SSD 6.0 Command Sets The Intel® Z-P230 PATA SSD... Feature Command Set The Intel® Z-P230 PATA SSD device supports the... 38h WRITE VERIFY 3Ch Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 6.1.1 IDENTIFY DEVICE DATA... number (20 ASCII characters) Intel® Z-P230 PATA Solid State Drive Product Manual 17 Intel® Z-P230 PATA SSD Table 14. Word...: 3D14h 16 GB: 3FFFh Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 14. Returned... Power mode 1 (Disabled) Reserved Intel® Z-P230 PATA Solid State Drive Product Manual 19 Intel® Z-P230 PATA SSD 6.1.2 READ MULTIPLE and... the current status of the Z-P230 PATA SSD. The BIOS or... ENABLE ATTRIBUTE AUTOSAVE D2h* Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 17. SMART... Management Command Set The Intel® Z-P230 PATA SSD devices support the....com electronic components distributor Intel® Z-P230 PATA Solid State Drive Product Manual 21 Intel® Z-P230 PATA SSD 8.0 Additional Product Information... ODM Original Design Manufacturer Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 21. Glossary... Updated the Decoder and “Intel Z-P230 PATA SSD Ordering Information” on... of ZIF module Figure 4, “Intel Z-P230 PATA SSD with ZIF Connector.... Updated the Decoder and “Intel Z-P230 PATA SSD Ordering Information” on... 3, “Functional Block Diagram of Intel Z-P230 PATA Solid State Drive” on...” on page 9 • Table 11, “Intel Z-P230 with Mini PCIe Form Factor... 2, “Front View • of the Intel Z-P230 PATA SSD with Mini PCIe Connector” on page 5 Figure 6, “Intel Z-P230 PATA SSD with Mini PCIe....com electronic components distributor Intel® Z-P230 PATA Solid State Drive Product Manual 23 Intel® Z-P230 PATA SSD Intel® Z-P230 PATA Solid State Drive...

Дата загрузки: 2017-01-16
Скачать документ
Скачать текст
Intel® Z-P230 PATA Solid State Drive SSDPAMM0004G1, ... Reserved for Future Use Intel Z-P230 PATA SSD Ordering Information Packaging... Corporation. All Rights Reserved. Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Contents 1.0 Overview ................................................................................................................... 5 1.1 Key...® Z-P230 PATA Solid State Drive Product Manual 3 Intel® Z-P230 PATA SSD Intel® Z-P230...-003US Intel® Z-P230 PATA SSD 1.0 Overview The Intel® Z-P230 PATA Solid-State..., low-power storage. The Intel Z-P230 PATA SSD is electronically-drop... 1. Front View of the Intel Z-P230 PATA SSD with ZIF Connector... 2. Front View of the Intel Z-P230 PATA SSD with Mini PCIe... Intel® Z-P230 PATA Solid State Drive Product Manual 5 Intel® Z-P230 PATA SSD... mm (W) x 3.8 mm (H) 1.2 Architecture The Intel Z-P230 PATA Solid State Drive is... PATA controller in the Intel® Z-P230 PATA Solid State Drive uses... 3, “Functional Block Diagram of Intel Z-P230 PATA Solid State Drive” on... to minimize system overhead. Intel Z-P230 PATA Solid State Drives use... and interleaved die operations. Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 1.3 Block Diagram Figure 3. Functional Block Diagram of Intel Z-P230 PATA Solid State Drive PATA... Memory Regulatory Compliance The Intel Z-P230 PATA SSD is compliant with... electronic compliance. Since the Intel Z-P230 PATA SSD is intended to...-user systems. While the Intel Z-P230 PATA SSD is EMC compliant... Intel® Z-P230 PATA Solid State Drive Product Manual 7 Intel® Z-P230 PATA SSD...-operating temperature Tstg 0 85 °C Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 3.3.2 Recommended Operating Conditions... Intel® Z-P230 PATA Solid State Drive Product Manual 9 Intel® Z-P230 PATA SSD.... 3.5.5 Electrostatic Discharge (ESD) The Intel Z-P230 PATA SSD can withstand an... data written is random. Intel® Z-P230 PATA Solid State Drive Product...-003US Intel® Z-P230 PATA SSD 4.0 Mechanical Information Figure 4. Intel Z-P230 PATA SSD... Order Number: 319955-003US Intel® Z-P230 PATA Solid State Drive Product Manual 11 Intel® Z-P230 PATA SSD Figure 5. Note: ZIF... dimensions are in millimeters. Intel® Z-P230 PATA Solid State Drive Product...: 319955-003US Intel® Z-P230 PATA SSD Figure 6. Intel Z-P230 PATA SSD with... Order Number: 319955-003US Intel® Z-P230 PATA Solid State Drive Product Manual 13 Intel® Z-P230 PATA SSD 5.0 Pin Assignments and... 5.1 Pin Assignments Table 10. Intel Z-P230 with ZIF Connector - 40 Pin... DMARQ 32 PDIAG# Signal Intel Z-P230 with Mini PCIe Form Factor... 39 DA1 GND 40 Intel® Z-P230 PATA Solid State Drive Product...-003US Intel® Z-P230 PATA SSD Table 11. Note: Intel Z-P230 with Mini... the device. Power supply. Intel® Z-P230 PATA Solid State Drive Product... 15 Intel® Z-P230 PATA SSD 6.0 Command Sets The Intel® Z-P230 PATA SSD... Feature Command Set The Intel® Z-P230 PATA SSD device supports the... 38h WRITE VERIFY 3Ch Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD 6.1.1 IDENTIFY DEVICE DATA... number (20 ASCII characters) Intel® Z-P230 PATA Solid State Drive Product Manual 17 Intel® Z-P230 PATA SSD Table 14. Word...: 3D14h 16 GB: 3FFFh Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 14. Returned... Power mode 1 (Disabled) Reserved Intel® Z-P230 PATA Solid State Drive Product Manual 19 Intel® Z-P230 PATA SSD 6.1.2 READ MULTIPLE and... the current status of the Z-P230 PATA SSD. The BIOS or... ENABLE ATTRIBUTE AUTOSAVE D2h* Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 17. SMART... Management Command Set The Intel® Z-P230 PATA SSD devices support the... Order Number: 319955-003US Intel® Z-P230 PATA Solid State Drive Product Manual 21 Intel® Z-P230 PATA SSD 8.0 Additional Product Information... ODM Original Design Manufacturer Intel® Z-P230 PATA Solid State Drive Product... Order Number: 319955-003US Intel® Z-P230 PATA SSD Table 21. Glossary... Updated the Decoder and “Intel Z-P230 PATA SSD Ordering Information” on... of ZIF module Figure 4, “Intel Z-P230 PATA SSD with ZIF Connector.... Updated the Decoder and “Intel Z-P230 PATA SSD Ordering Information” on... 3, “Functional Block Diagram of Intel Z-P230 PATA Solid State Drive” on...” on page 9 • Table 11, “Intel Z-P230 with Mini PCIe Form Factor... 2, “Front View • of the Intel Z-P230 PATA SSD with Mini PCIe Connector” on page 5 Figure 6, “Intel Z-P230 PATA SSD with Mini PCIe... Order Number: 319955-003US Intel® Z-P230 PATA Solid State Drive Product Manual 23 Intel® Z-P230 PATA SSD Intel® Z-P230 PATA Solid State Drive...

Дата загрузки: 2016-12-29
Скачать документ
Скачать текст

Дата загрузки: 2017-01-16
Скачать документ
Скачать текст
P230 Assessment Consultation Responses Consultation Issued ... 1: Do you believe Proposed Modification P230 would better facilitate the achievement... Yes We believe Proposed Modification P230 will better facilitate Applicable BSC... electricity is better facilitated by P230 by ensuring that a Change of... the report that the Proposed P230 Assessment Report consultation responses 2 February... Response Services Limited Rationale Modification P230 would better facilitate the achievement... with the Modification Group that P230 meets BSC objectives C & D. With regard... believe that the Proposed Modification P230 will better facilitate the achievement... the efficiency of Settlement processes. P230 Assessment Report consultation responses 2 February... delivers the intended solution for P230? Summary Yes 7 No 0 Neutral/Other... within the scope of the P230. We believe that the amended... delivers the intended solution for P230 better that the legal text... of the modification process for P230, legal text might be approved... of the new revised text ‘P230 Proposed Legal Text v0.2’ ScottishPower... lies not in the proposed P230 Assessment Report consultation responses 2 February... the COPs. The text within ‘P230 Proposed Legal Text v0.1’ seems... The proposed wording is appropriate. P230 Assessment Report consultation responses 2 February... any quantifiable benefits related to P230? Summary Yes 1 No 6 Neutral/Other... there are benefits of proposal P230 in terms of improved interoperability... time to quantify benefits from P230 other than that the modification supports the proposed license changes. P230 Assessment Report consultation responses 2 February... accurate reflects the intent of P230 and that no amendment is... the MID issue is resolved. - P230 Assessment Report consultation responses 2 February... there any further comments on P230 that you wish to make... - TMA Data Management Ltd No - P230 Assessment Report consultation responses 2 February... the BSC. British Energy No - P230 Assessment Report consultation responses 2 February...

Дата загрузки: 2016-12-20
Скачать документ
Скачать текст
...-2012 MLPA ® SALSA MLPA probemix P230-B1 Human Telomere-7 Lot 0609... × 25 reactions is € 1200. This P230-B1 probemix can be used... subtelomere screening. This SALSA® MLPA® P230-B1 Human Telomere-7 probemix contains... telomere analysis, such as this P230-B1 Human Telomere-7 probemix. This..., the Netherlands SALSA MLPA probemix P230 Human Telomere-7 : Page 1 of 7 MRC..., 14q-cen Data analysis The P230-B1 Human Telomere-7 probemix contains...@mlpa.com. SALSA MLPA probemix P230 Human Telomere-7 Page 2 of 7 MRC...-12-2012 ® Table 1. SALSA MLPA P230-B1 Human Telomere-7 probemix Chromosomal... p-telomere (hg18). SALSA MLPA probemix P230 Human Telomere-7 Page 3 of 7 MRC... 11; 21-12-2012 ® Table 2. P230 probes arranged according to chromosomal...@mlpa.com. SALSA MLPA probemix P230 Human Telomere-7 Page 4 of 7 MRC...@mlpa.com. SALSA MLPA probemix P230 Human Telomere-7 Page 5 of 7 MRC...-12-2012 ® SALSA MLPA probemix P230-B1 Human Telomere-7 sample picture... analysed with SALSA MLPA probemix P230-B1 Human telomere-7 (lot 0609... analysed with SALSA MLPA probemix P230-B1 Human telomere-7 (lot 0609... a yellow label. SALSA MLPA probemix P230 Human Telomere-7 Page 6 of 7 MRC... layout changes. SALSA MLPA probemix P230 Human Telomere-7 Page 7 of 7

Дата загрузки: 2017-01-16
Скачать документ
Скачать текст
флюС P230 P230 Классификация Флюс ISO 14174 S A AB 1 ...-A: МС P230 / LNS 135 P230 / L-61 P230 / L-50M (LNS 133U) P230 / LNS 140A P230 / L-70 P230 / LNS 160 P230 / LNS 162 P230... 25 45 75 50 80 P230-1: вер. EN 24 Насколько нам... флюсом Класс проволоки флюС флюС P230 P230 Классификация Флюс ISO 14174 S A AB...-A / ISO 26304 P230 / LNS 150 F8P2-EB2-B2R P230 / LNS 151 F9PZ...-A S CrMo1 S CrMo2 P230 / LNS 163 S 38 4 AB S2 NiCu P230 / LNS 164...-EF1*-F3 S 50 4 AB S3NiMo1 P230 / LNS 168 Марки стали / Стандарт... Sahara ReadyBag™ (SRB) 25 25 P230-2: вер. EN 24 Насколько нам...

Дата загрузки: 2017-02-06
Скачать документ
Скачать текст
... conservation tillage and manure applications. P230 Soil organic matter storage in... Alavoine, G.: P220 Albanito, F.: P575 Albrecht, A.: P230 Albrecht, C.: P320, S26.F.01, S26....M.01 Bernier-Latmani, R.: P070 Bernoux, M.: P230, S02.H.03 Berns, A. E.: S01.E.03..., A.: S07.H.04 Chapuis-Lardy, L.: P228, P230, S08.E.03 Charoulis, A. V.: P088, P614..., M. V.: P451 Rakonczai, J.: P582 Rakotoarinivo, C.: P230 Rakotondrasolo, F. N.: P230 Raluca, S. N.: P471 Ramazanova, F. M.: S17.J.02..., X.: S01.D.04, S23.C.02 Razafimbelo, T. M.: P230 Razavi, S.: P053 Razzouk, R.: P232 Recatala... structure: P035 macropores: P618 Madagascar: P230 magnesium and calcium: S09.N.06....K.01 Soil organic carbon storage: P230 soil organic matter: P180, P181... soil test P: P456 Soil texture: P230, P321 soil texture classes: P696...